PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_8F3BD4450.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 361aa    MW: 41321.2 Da    PI: 9.9696
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_8F3BD4450.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-15655148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                           r+rW +eEd +l  +v+q+G++ W+++a++m+  + R +k+c +rw +yl
  Traes_5DS_8F3BD4450.2  6 RQRWRPEEDAILRSYVRQYGPREWNLVAQRMNvpLDRDAKSCLERWKNYL 55
                           89**********************************************97 PP

2Myb_DNA-binding347e-1161105147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Traes_5DS_8F3BD4450.2  61 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                            57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.015159IPR017930Myb domain
SMARTSM007178.7E-13557IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-216100IPR009057Homeodomain-like
CDDcd001672.20E-8855No hitNo description
Gene3DG3DSA:1.10.10.603.6E-21862IPR009057Homeodomain-like
PfamPF139219.5E-14969No hitNo description
SMARTSM007171.4E-960108IPR001005SANT/Myb domain
PROSITE profilePS5129418.09660110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-1463104IPR009057Homeodomain-like
CDDcd001672.95E-665106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEMKERQRWR PEEDAILRSY VRQYGPREWN LVAQRMNVPL DRDAKSCLER WKNYLRPGIK  60
KGSLTDDEQR LVIRLQAKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ REIRDSRRPP  120
PEPSPDERGR YEWLLENFAE KLVKERQQVG VGATPLHHHL MAAPMLPPSM SSTATNGAPV  180
SPAPPSPSVT LSLASAVVPP PTAAPWMQQQ MAEDGAAFGF ARPPPAPGMV ADAPQAALAE  240
LAECCRELDE GHRAWAAHRK EASWRLKRVE LQLESERACR RREAAEEFEA KMRALWEEQA  300
AAVERLEAEY REKVAGLRRD AELKEQKMAE QWAAKHARLT KFLEQVGSSC RRWPPGEMNG  360
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-159103798MYB PROTO-ONCOGENE PROTEIN
1msf_C6e-159103798C-Myb DNA-Binding Domain
1mse_C6e-159103798C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4434560.0AB443456.1 Triticum aestivum WRS2 mRNA for Myb transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579268.11e-173PREDICTED: protein rough sheath 2
RefseqXP_014758382.11e-173PREDICTED: protein rough sheath 2
SwissprotQ94IB11e-146RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLW5G3780.0W5G378_WHEAT; Uncharacterized protein
STRINGBRADI4G03970.11e-172(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.13e-99MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]